LL-37: Human Cathelicidin Antimicrobial Peptide Research Overview
LL-37 is the only cathelicidin-class antimicrobial peptide in humans. It is a 37-amino acid amphipathic peptide derived from the C-terminal of the human cathelicidin antimicrobial protein hCAP18. The compound has been extensively studied in preclinical research on innate immune defense, microbial membrane disruption, and immunomodulatory signaling. This page summarizes the published literature.
In Stock · Ships Same Day
Order LL-37
Lyophilized synthetic reference compound. 7x independently tested. Full Certificate of Analysis with every batch.
Background
Cathelicidins are a family of antimicrobial peptides produced as inactive proproteins that are cleaved by extracellular proteases to release the active C-terminal peptide. Humans produce only one cathelicidin, called hCAP18, which is cleaved to release the active 37-amino acid peptide LL-37 (named for its two N-terminal leucines).[1]
LL-37 is produced by neutrophils, epithelial cells, and other immune cells as part of the innate immune defense system. The peptide has direct antimicrobial activity against a broad spectrum of pathogens (bacteria, fungi, some viruses) and also serves immunomodulatory roles independent of its direct microbial killing.[2]
LL-37 is studied as a research reference compound in innate immunology and antimicrobial peptide pharmacology. It has not been approved by the FDA for any human therapeutic or medical purpose.
Chemistry & Structure
LL-37 structural features:
- Sequence: [LL-37, 37 aa] (37 residues, one-letter code)
- Length: 37 amino acids
- Structure: amphipathic α-helix in membrane environments
- Net charge: +6 at physiological pH (multiple Arg and Lys residues)
- Molecular formula: C₂₀₅H₃₄₀N₆₀O₅₃
- Molecular weight: approximately 4,493 Da
Amphipathic helix architecture
When LL-37 binds bacterial membranes, it adopts an amphipathic α-helical structure with hydrophobic residues on one face and positively charged residues on the opposite face. This architecture allows the peptide to insert into negatively charged microbial membranes while sparing zwitterionic mammalian cell membranes.[3]
The selectivity for microbial vs mammalian membranes derives from membrane composition: bacterial membranes have negatively charged phosphatidylglycerol and cardiolipin, while mammalian cell outer membranes are predominantly zwitterionic phosphatidylcholine.
Mechanism Research
LL-37's research-characterized activities span direct antimicrobial and immunomodulatory functions.
Microbial membrane disruption
LL-37 binds negatively charged microbial membranes through electrostatic attraction, then inserts to form transmembrane pores or otherwise disrupt membrane integrity. This kills the microbe by leakage of cellular contents. The mechanism has been characterized in bacterial liposome systems and live bacteria preparations.[3]
Immunomodulatory signaling
Beyond direct antimicrobial action, LL-37 binds the formyl peptide receptor 2 (FPR2) and other receptors on immune cells, modulating cytokine production, chemotaxis, and cell migration. This 'immunomodulatory' role is a major research area in modern cathelicidin biology.[4]
Wound healing and angiogenesis research
Preclinical research has examined LL-37 in cell-based and animal models of wound healing, with endpoints including angiogenesis markers, keratinocyte migration, and re-epithelialization.[5]
Buy LL-37 Research Material
Lab tested · Full COA · Ships same day from US facility
Documented Preclinical Research Areas
LL-37 literature spans innate immunity and applied antimicrobial research.
Antibacterial mechanism research
Cell-free liposome systems and live bacterial preparations are common substrates for LL-37 mechanism research. Endpoints include minimum inhibitory concentrations (MICs), bacterial membrane permeability assays, and structural studies of peptide-membrane interactions.[3]
Cancer cell biology research
Cathelicidin expression has been examined in various cancer cell preparations. The peptide has dual reported effects in different tumor types, pro-tumorigenic in some contexts, anti-tumorigenic in others, reflecting the complexity of immunomodulatory signaling.[6]
Inflammatory disease research
LL-37 dysregulation has been characterized in several inflammatory diseases including psoriasis (where LL-37 contributes to autoinflammatory signaling). Cell-based and skin preparation studies have examined the compound's role.[4]
Stability & Handling
LL-37 is a large, highly charged peptide. Standard peptide handling applies.
Storage
Lyophilized LL-37 is stored at minus 20 degrees Celsius for long-term preservation.
Reconstitution
Bacteriostatic water or sterile water are standard reconstitution solvents. The highly charged peptide is readily water-soluble.
Quality verification
HPLC for purity, mass spectrometry for identity confirmation matching the 37-amino acid sequence, and endotoxin screening. Each batch of Instant Peptides LL-37 ships with a full Certificate of Analysis.
Available Research Material
Instant Peptides supplies LL-37 as a synthetic lyophilized reference compound. Material is supplied to qualified research professionals. Not for human or animal consumption.
View the product page for current pricing and the Certificate of Analysis for the active batch.
Ready to order?
Get LL-37 Today
Independently lab-tested with a published Certificate of Analysis for every batch. Lyophilized synthetic reference compound, shipped same day from a US facility.
View product detailsCommon Questions
What is LL-37?
What research areas involve LL-37?
How is LL-37 characterized in laboratory settings?
What makes LL-37 relevant to current research?
How is product quality verified?
References
- 1.Zanetti M. Cathelicidins, multifunctional peptides of the innate immunity. Journal of Leukocyte Biology. 2004. PMID: 14982952
- 2.Vandamme D, Landuyt B, Luyten W, Schoofs L. A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cellular Immunology. 2012. PMID: 22921188
- 3.Sochacki KA, Barns KJ, Bucki R, Weisshaar JC. Real-time attack on single Escherichia coli cells by the human antimicrobial peptide LL-37. Proceedings of the National Academy of Sciences. 2011. PMID: 21205829
- 4.Mookherjee N, Anderson MA, Haagsman HP, Davidson DJ. Antimicrobial host defence peptides: functions and clinical potential. Nature Reviews Drug Discovery. 2020. PMID: 32433559
- 5.Heilborn JD, Nilsson MF, Kratz G, et al. The cathelicidin anti-microbial peptide LL-37 is involved in re-epithelialization of human skin wounds and is lacking in chronic ulcer epithelium. Journal of Investigative Dermatology. 2003. PMID: 12603848
- 6.Wu WK, Sung JJ, To KF, et al. The host defense peptide LL-37 activates the tumor-suppressing bone morphogenetic protein signaling via inhibition of proteasome in gastric cancer cells. Journal of Cellular Physiology. 2010. PMID: 20151396